.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4255

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4255
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26144,AAD35626, 2336 TM0541 Molecular Weight 18172.16 Da.
    Residues 164 Isoelectric Point 9.49
    Sequence mriedlkagqeirysgklivmrdqaqrrlkeivdrgeeppvdlrgqivfyagpaktpsgkpvgaigptts armddylemlfklgaiatigkgkrskkaieackkwkrvyfvtpsgtaaalskrvkksrvlafedlgpea iyeievedfplivaidsngntifke
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0541

    Name: fumarase
    Other genes that carryout this rxn:TM0540
    Metabolic Subsystem: Citric Acid Cycle
    Reaction: : fum + h2o <==> mal-L
    Classification: EC:4.2.1.2
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0541
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch