.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4258

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4258
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26194,AAD35636, 2336 TM0551 Molecular Weight 59778.19 Da.
    Residues 554 Isoelectric Point 5.88
    Sequence mrsdvikkglervphrsllkalgitddemrrpfigivsswneiipghvhldkvveavkagvrmaggvpfv fptigicdgiamdhrgmkfslpsreliadsieivasgfpfdglvfvpncdkitpgmmmamgrlnipsvl isggpmlagryngrdidlitvfeavggykvgkvdeetlkaiedlacpgagscaglftantmnslaealg iaprgngtvpavhakrlrmakeagmlvvelvkrdvkprdivtldsfmnavmvdlatggstntvlhlkai aesfgidfdiklfdelsrkiphicnispvgpyhiqdlddaggiyavmkrlqengllkedvmtiylrkig dlvreakilnedvirpfdnpyhkegglgilfgnlapegavaklsgvpekmmhhvgpavvfedgeeatka ilsgkikkgdvvviryegpkggpgmremlsptsaivgmglaedvalitdgrfsggshgavighvspeaa eggpigivkdgdlieidfekrtlnllisdeeferrmkeftplvkevdsdylrryaffvqsaskgaifrkp
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0551

    Name: "dihydroxy-acid dehydratase (2,3-dihydroxy-3-methylbutanoate)"
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : 23dhmb --> 3mob + h2o
    Classification: EC:4.2.1.9
     
    Name: "Dihydroxy-acid dehydratase (2,3-dihydroxy-3-methylpentanoate)"
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : 23dhmp --> 3mop + h2o

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0551
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch