.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4259

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4259
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26362,AAD35637, 2336 TM0552 Molecular Weight 60286.35 Da.
    Residues 538 Isoelectric Point 5.58
    Sequence msikvydttlrdgaqafgvsfsledkiriaealddlgvhyleggwpgsnpkdiaffeavkgmnfknlkva afsstrrpdvkieedaniqtlikaetpvytifgkswdlhvekalrttleenlkmiydtvsylkrfadev iydaehffdgykanreyalktlkvaeeagadclvladtnggtlpheieeiiedvkkhvkaplgihahnd sdvavantlaavrkgavhvqgtinglgercgnanlcsvipnlvlkmglevipkenlkklfdvahlvael sgrphienmpyvgdyafahkggvhvsaikrdprtyehidpelvgnrriisiselsgksnvlekikemgf eidesspkvreilkkikeleaqgyhfegaeasfellvrdmlgkrkkyfeflgftvmtiknrdeesfsea tvkvrvpdevakrlghdepfehtaaegegpvealdravrkalekfypslkdtkltdykvrilneqagtk attrvliessdgkrrwgtvgvspniieaswtallesleyklhkdeeemrndeen
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0552

    Name: 2-isopropylmalate synthase
    Other genes that carryout this rxn:TM0553
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : 3mob + accoa + h2o --> 3c3hmp + coa + h
    Classification: EC:4.1.3.12
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0552
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch