.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4261

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4261
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26418,AAD35640, 2336 TM0555 Molecular Weight 18450.21 Da.
    Residues 166 Isoelectric Point 5.12
    Sequence mvvkikgkvfvfgdnvntdeiiparylntsdpqelakycmedarpgfgrrddikgsiivagenfgcgssr ehapvaikaagiscviaksfariffrnainiglpivelkeadefeegdiaevdlengvvrnltkgkeyr irpypeflmkimeaggwleyclkevge
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0555

    Name: 2-isopropylmalate hydratase
    Other genes that carryout this rxn:TM0554
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : 2ippm + h2o <==> 3c3hmp
    Classification: EC:4.2.1.33
     
    Name: 3-isopropylmalate dehydratase
    Other genes that carryout this rxn:TM0554
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : 3c2hmp <==> 2ippm + h2o
    Classification: EC:4.2.1.33
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0555
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch