The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4278
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26274,AAD35672, 2336 TM0587 Molecular Weight 28162.44 Da.
    Residues 248 Isoelectric Point 6.55
    Sequence lkdvrkkvilvdhneitqapegvekaeileiidhhrlgglstlnpvffynepvgststivaefflkngvk mereiagillsgivsdtlffklstttekdrkmanfladvakldlekfakkllkegmkipedvdpaellk rdvkvyemgeesfavsqimtsdfstllkekerfmntlktlkgefgvkhffvlftnpveeasllmmdgdq klvekafnaekkdglfllkgvmsrkkdfvpkigevlrrer
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0587

    Name: inorganic diphosphatase
    Other genes that carryout this rxn:TM0913
    Metabolic Subsystem: Energy Metabolism
    Reaction: : h2o + ppi --> h + pi
    Classification: EC:

    Ligand Information
    Model TM0587
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch