.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4313

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4313
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26154,AAD35731, 2336 TM0647 Molecular Weight 17832.32 Da.
    Residues 165 Isoelectric Point 4.92
    Sequence mesdpmfigfgydrhplvegrrlvlagveidaplgslghsdgdvlshaiidallgagclgdigtwfpetk eykdansldllketvkileergfsvvnvdatvvasivklspyrekivenlksaletsrvnvkfksgntl gfegeergisayavclveekgctkst
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0647

    Name: "2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase"
    Metabolic Subsystem: Terpenoid biosynthesis
    Reaction: : 2p4c2me --> 2mecdp + cmp

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0647
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch