The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4314
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32449,AAD35732, 2336 TM0648 Molecular Weight 15263.57 Da.
    Residues 132 Isoelectric Point 4.97
    Sequence myeeyirawverkkkeeekmkllahkaleearkvtgvlrekygakrvvlfgslakylrgageftersdid laveglpkeeyfrvlseinrlsefevdlidlegcpaflrslieregmeieegtdsltdsgdr
      BLAST   FFAS

    Ligand Information
    Model TM0648
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch