The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4328
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26268,AAD35754, 2336 TM0666 Molecular Weight 24780.46 Da.
    Residues 220 Isoelectric Point 9.16
    Sequence mrllfrkageffrdfvsifkhisddlemylkldpaaesklqvfffyasfqglmwyrfahffykwklkvla yliyyfvrvvfsmdihpaariapgvvidhgigvvigstasvgrgtliyhgvtlgtrkpcsgkrhpdvge nvmigtgakilgpirvgnnavvganavvledvpdgavvvgvparivkwrrdfcddgktdrehsysetrf drlenlletgke
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0666

    Name: serine O-acetyltransferase
    Metabolic Subsystem: Cysteine Metabolism
    Reaction: : accoa + ser-L <==> acser + coa
    Classification: EC:

    Ligand Information
    Model TM0666
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch