.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4343

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4343
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32442,AAD35776, 2336 TM0694 Molecular Weight 49895.19 Da.
    Residues 425 Isoelectric Point 4.79
    Sequence mevkelerdknrvvleyvfgaeeiaqaedkavrylnqrveipgfrkgripknvlkmklgeefqeytldfl mdlipdtlkdrklilspivterelkdvtarvvvevheepevrigdiskievekvdeekvlekyverrie dlreshallepkegpaeagdlvrvnmevyneegkkltsreyeyvisededrpfvkdlvgkkkgdvveie reyegkkytykleveevykrtlpeigdelaksvnnefetleqlkeslkkegkeiydvemkesmreqlle klpeiveieisdrtleilvneainrlkregryeqivssyeseekfreelkerilddikrdrvievlaqe kgisvndeelekeaeelapfwgispdrakslvkarqdlreelrwailkrkvldlllqevkvkvvepkge gddsegkedn
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0694
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch