.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4348.2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC4348.2
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32409,NP_228517.1, 3.90.1550.10, 243274 TM0708 Molecular Weight 25560.28 Da.
    Residues 227 Isoelectric Point 8.83
    Sequence miekgvfpgalnmaidslmaewsanmnsvlfrfygwkrptvslgrfqkedginvpdwidvvrrpsggral lhhreityclavpkkinfgklsvlefhrlvhslirdalveaglhaelsskrrgntalcfdapsryeivi ngvkvvgsaqfrtaesivehgsivlkqdidllktifgedvpplkgildlydvdvkaleerilaqfekvf gtsrkiqldssmlkearer
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0708
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch