.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4357

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4357
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26182,AAD35801, 2336 TM0719 Molecular Weight 53415.31 Da.
    Residues 460 Isoelectric Point 6.04
    Sequence mritntltgkkeefvpiqpgvvrmyvcgptvydlihvgnarpalvfdvfrryleyrgyrvimvqnftdid dkiinkanqlgvdyktvadtfiaeywrdahalgirpanfhprttdfvediveiieklvekgfayqtetg vyfdvrkfekygelskkkiedliagarvevdetkkspldfslwkkakpgepcwkspwgegrpgwhiect vmsvkilgesfdihaggedlvfphhenekaqaealtgkvfarywmhngmvrflgdkmskstgniftvre avkrygrdglrymilskhyrspmdfseellqdysravkrvweilgryeksgdigipkrnavyeeyvnrf vealdddfntpvavslifelarnlskamddndredallyyhlirrefgpvlglfdlneekkevsseell kllievrdvlrkekrydlsdrirdrlreigiilkdtpsgteytve
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0719

    Name: Cysteinyl-tRNA synthetase
    Other genes that carryout this rxn:TM1410
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : atp + cys-L + trnacys --> amp + cystrna + ppi
    Classification: EC:6.1.1.16
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0719
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch