.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4404

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4404
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26298,AAD35870, 2336 TM0788 Molecular Weight 47152.03 Da.
    Residues 424 Isoelectric Point 5.72
    Sequence mtqmemarkgvvsdemkkvaeyegvdveivrqklaegravlpknklhrierpmivgegfsvkvnanigts qgfssleeekekarvaieygadslmvlstwgdlreirraivemspvpvgsvpiydsavrsyqmkknvvd fsekdffdmviahaedgidfmtihvgvtrrvldrikssrrvlkivsrggaiiagwmiknnkenpfyehf delldiakdyditlslgdgmrpgavvdasdaqqfeelfvmgelverarekgvqvmlegpghvplnevem nvrlmkkigkgapifllgplptdramgydhiacaiggalagyygadflcyvtpsehislpdvedvregv iaskiaaivadvargnkkawelekkmalarknfdwetmfslslgkdvakkkyeerpypdkgcsmcgpfc aikiaeefs
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0788

    Name: 4-amino-5-hydroxymethyl-2-methylpyrimidine synthetase
    Metabolic Subsystem: Thiamine Biosynthesis
    Reaction: : air + h --> 4ahmmp + gcald + pi

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0788
    generated 12/2008

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch