.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4406

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4406
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26370,AAD35872, 2336 TM0790 Molecular Weight 45390.10 Da.
    Residues 398 Isoelectric Point 6.75
    Sequence mvlvvagfdpsggagiiqdvkvlsalgvkthavisaltvqnenrvfsvnfrdweemrkeievltpprvik vglsapetvkrlremfpdsaivwnvvlesssgfgfqdpeevkkfveyadyvilnseeakklgeynnfiv tgghekgntvkvkyrdfvfeiprvpgefhgtgcafssavsgflamsypveeairsamellkkilerssg vvetekllrdwyrydtlntldeilpefleighltvpevgqnvsyalpwaknefevgkfpgrirlkegka vavscasfkdrshtarmavtmmryhphmrcvvnvryereyverakkrglkvfhydrskepkevqekegq smvwmieqaiaelksppdviydegwwgkeamirvfgrnpkevlekiklmvre
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0790

    Name: hydroxymethylpyrimidine kinase (ATP)
    Metabolic Subsystem: Thiamine Biosynthesis
    Reaction: : 4ahmmp + atp --> 4ampm + adp + h
    Classification: EC:2.7.1.49
     
    Name: phosphomethylpyrimidine kinase
    Metabolic Subsystem: Thiamine Biosynthesis
    Reaction: : 4ampm + atp --> 2mahmp + adp
    Classification: EC:2.7.4.7
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0790
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch