.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4413

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4413
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26180,AAD35883, 2336 TM0801 Molecular Weight 15299.22 Da.
    Residues 137 Isoelectric Point 7.90
    Sequence mnidyvksilphrypfllvdgvieesedrivafknisisdpvfqghfpeypiypgvliveglaqtagill lksvegiplflgidearfkkevrpgdrliyevrklgeklgtvqvegvakvddkivakarlllgvkkk
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0801

    Name: 3-hydroxy-palmetoyl-ACP synthesis
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> 3hpalmACP + ACP + co2 + nadp

     
    Name: Fatty acid biosynthesis (n-C14:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ddcaACP + h + malACP + nadph --> ACP + co2 + h2o + myrsACP + nadp

     
    Name: Fatty acid biosynthesis (n-C24:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : behenACP + h + malACP + nadph --> ACP + co2 + h2o + lgnACP + nadp

     
    Name: Fatty acid biosynthesis (n-C20:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + ocdcaACP --> ACP + arachACP + co2 + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C16:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> ACP + co2 + h2o + hdeACP + nadp

     
    Name: Fatty acid biosynthesis (n-C22:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : arachACP + h + malACP + nadph --> ACP + behenACP + co2 + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C18:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> ACP + co2 + h2o + nadp + octeACP

     
    Name: 3-hydroxy-octadecanoyl-ACP synthesis
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> 3hoctaACP + ACP + co2 + nadp

     
    Name: Fatty acid biosynthesis (n-C20:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + ocdcaACP --> ACP + aracheACP + co2 + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C10:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : actACP + h + malACP + nadph --> ACP + co2 + dcaACP + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C18:2)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + palmACP --> ACP + co2 + h2o + ocdcyaACP

     
    Name: Fatty acid biosynthesis (n-C12:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : dcaACP + h + malACP + nadph --> ACP + co2 + ddcaACP + h2o + nadp

     
    Name: Fatty acid biosynthesis (n-C14:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : ddcaACP + h + malACP + nadph --> ACP + co2 + h2o + nadp + tdeACP

     
    Name: Fatty acid biosynthesis (n-C16:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + myrsACP + nadph --> ACP + co2 + h2o + nadp + palmACP

     
    Name: Fatty acid biosynthesis (n-C18:0)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : h + malACP + nadph + palmACP --> ACP + co2 + h2o + nadp + ocdcaACP

     
    Name: Fatty acid biosynthesis (n-C22:1)
    Other genes that carryout this rxn:TM0800 TM0798 TM1724 TM1169 TM0802
    Metabolic Subsystem: Fatty Acid Synthesis
    Reaction: : arachACP + h + malACP + nadph --> ACP + beheneACP + co2 + h2o + nadp

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0801
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch