.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4414

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4414
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26390,AAD35885, 2336 TM0803 Molecular Weight 59488.61 Da.
    Residues 524 Isoelectric Point 5.82
    Sequence mkkyvivtggvlsgigkgifsaslarlmkehgvdvnvlkidpylnvdagtmnpnqhgevfvtedgyeadl dlghyerflgrdmtrqnnmtagqvylrviekerqgkylgntvqivphlteeikdriraleaellvveig gtvgdiegevfleavrelqmeegkenflfahvtyvpylrttnefktkptqqsvqllrrigitpdmvivr sefpldvpsmnkvalfsgvprdfvinlpdtknvyevpeilrdmglhekiasklnvelkkstfnwsypka fkpyrialvgkylgtddayksiiesvfltgiekptvvdsqmledmndeevkkvldeydaliipggfgrr gvegkikaikyarenkkpilgiclgmqlmviefarnvfgykeanstefdpntpypvvdlmeeqkrilkl ggtmrlgaqkvkifpktklyevyggveevyerhrhryeaneeafpelfkkpgeegyklvvsaksdfiea veledhpffvgvqfhpeykskvgaphpifvylrkvlegsq
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0803

    Name: CTP synthase (glutamine)
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : atp + gln-L + h2o + utp --> adp + ctp + glu-L + h + pi
    Classification: EC:6.3.4.2
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0803
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch