The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4415
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26324,AAD35886, 2336 TM0804 Molecular Weight 27142.48 Da.
    Residues 233 Isoelectric Point 5.07
    Sequence midmhlhstfsydgkaeiddiisqvqklgiehfcitdhyeyengelvhdfnveeyfltmekydlpkgaei swdgvgeavfpdgfdylllgihrydenlppdelardylertlfvmervkfhtlahldyparyakadfka nrdliekilvflvknekaleintaglfkhgkpnpdywivemyydlggrvvtigsdahesqhigrgieev mrelkkfnfeylavdgkklvtvklr
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0804

    Name: histidinol-phosphatase
    Metabolic Subsystem: Histidine Biosynthesis
    Reaction: : h2o + hisp --> histd + pi
    Classification: EC:

    Ligand Information
    Model TM0804
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch