.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4417

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4417
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26428,AAD35891, 2336 TM0809 Molecular Weight 52375.16 Da.
    Residues 467 Isoelectric Point 5.02
    Sequence mdvdlgklffcgfndfneevkeiirkyrptgiliypgvlskeyllmdfmsflskegdflissdheggqle vlkyvpsspgnlafgknspdvtyrysrvagkimeivglnmvfapvldllseesssvidirsygsdpkiv aehgaracegyleggvipcikhfpghgkaredshltlpvvdapfeklweedllpfrkvlerekkvtvmt ahvryssidslpatlsekiitdvlrekigfdglvisdamemsavsnnfsveeivslflnaggnmillgd yrnlpvyyetlvklledgkvqkdkversirtvekylafakknsgvgfladvsmkaveflgfekidhtse vtllvpssenlsqadttggdydqipeivsrffevenvvrytvedgpefvegdlifdfvadipnekalka hlslpaektvyfvlrnpfdvryfegrkivvtrstkpisiykslehflgrcds
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0809

    Name: "beta-N-acetylhexosaminidase, cytosol"
    Metabolic Subsystem: Aminosugar Metabolism
    Reaction: : chtbs + h2o --> acgam
    Classification: EC:3.2.1.52
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0809
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch