.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4449

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4449
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32233,AAD35960, 2336 TM0879 Molecular Weight 7131.94 Da.
    Residues 65 Isoelectric Point 4.85
    Sequence mgykivvnydwckacklcawacptsaitsdeigkpvtnenkcigclkcekicpdmaieivsdena
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0879
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch