.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4455

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4455
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26416,AAD35970, 2336 TM0889 Molecular Weight 42197.73 Da.
    Residues 376 Isoelectric Point 6.07
    Sequence meertlvilgatgsigtqtldvlkkvkgirligisfhsnlelafkivkefnvknvaitgdvefedssinv wkgshsieemlealkpditmvavsgfsglravlaslehskrvclankeslvcggflvkkklkekgteli pvdsehsaifqvmepevekvvltasggalrdwkiskidrarpedvlkhpvwnmgaritvdsatmvnkaf evleamelfelpfekievkihreglvhgavvlpdgnvkmvvsppdmripisyalfyprrvalepfflrt islsfedpdpekypaffllkeikdsyalrtafnaadevaveaflkgrirfggihrviektleefqgypq prtlddverihfeaikkaervtewlsstsy
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0889

    Name: 1-deoxy-D-xylulose-5-phosphate reductoisomerase
    Metabolic Subsystem: Terpenoid biosynthesis
    Reaction: : dxyl5p + h + nadph <==> 2me4p + nadp

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0889
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch