.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4472

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Diffraction
    Target Id APC4472
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4607,AAD35994, 2336 TM0913 Molecular Weight 29803.37 Da.
    Residues 255 Isoelectric Point 4.86
    Sequence mkeagilfeelvsimeklrspegcewdrkqtheslkpylieecyelieaideknddmmkeelgdvllqvv fhaqiarergaftiedvirtlneklirrhphvfgdspgysykqwedikaqekgkkkssrigeinplvpa lsmarriqenasqvgfdwkdpegvyekieeelkelkeakdpreleeefgdllfsivnlsrflnvdpesa lrkatrkfverfkkmeeliekdglvleelpiekldeywekakggdet
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0913

    Name: inorganic diphosphatase
    Other genes that carryout this rxn: TM0587
    Metabolic Subsystem: Energy Metabolism
    Reaction: : h2o + ppi --> h + pi
    Classification: EC:3.6.1.1
     
    Name: Nucleoside triphosphate pyrophosphorylase (gtp)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : gtp + h2o --> gmp + h + ppi

     
    Name: Nucleoside triphosphate pyrophosphorylase (datp)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : datp + h2o --> damp + h + ppi

     
    Name: Nucleoside triphosphate pyrophosphorylase (dgtp)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : dgtp + h2o --> dgmp + h + ppi

     
    Name: Nucleoside triphosphate pyrophosphorylase (atp)
    Metabolic Subsystem: Purine Metabolism
    Reaction: : atp + h2o --> amp + h + ppi

     
    Name: Nucleoside triphosphate pyrophosphorylase (utp)
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : h2o + utp --> h + ppi + ump

     
    Name: Nucleoside triphosphate pyrophosphorylase (ctp)
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : ctp + h2o --> cmp + h + ppi

     
    Name: dUTP diphosphatase
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : dutp + h2o --> dump + h + ppi
    Classification: EC:3.6.1.23
     
    Name: Nucleoside triphosphate pyrophosphorylase (dttp)
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : dttp + h2o --> dtmp + h + ppi

     
    Name: Nucleoside triphosphate pyrophosphorylase (dctp)
    Metabolic Subsystem: Pyrimidine Metabolism
    Reaction: : dctp + h2o --> dcmp + h + ppi

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0913
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch