.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4487

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4487
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26200,AAD36020, 2336 TM0939 Molecular Weight 12837.24 Da.
    Residues 114 Isoelectric Point 6.61
    Sequence mlniylkskihmatitrkevyyegsieideelmgkagisegelvlvvnvnnaerfvtyvikgkrgsrein lygaaarlgeegdrviimaftfsdkpvkaktivlnekneivqek
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0939

    Name: aspartate 1-decarboxylase
    Metabolic Subsystem: Alanine and Aspartate Metabolism
    Reaction: : asp-L + h --> ala-B + co2
    Classification: EC:4.1.1.11
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0939
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch