.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4491

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4491
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32353,AAD36027, 2336 TM0946 Molecular Weight 34246.65 Da.
    Residues 316 Isoelectric Point 4.02
    Sequence mkaifpvilallflsgcfqmipalpqekvyalvatgeglevfdvtatpvsisfvslansaldvevsgqya fladgqsgihvldvsdpenpvqlnqlnthyaygvdlsgdylyvadwtngllvynvtdpsspvlvarlee adwaekvhisgnrayvacyneglkvvdvsnpanpvflervnfgtvrsvfvsderiyavvygegvsiida ndlsqilgtyesqtpydvivsdsvlyladyafgvqtidvsdpgnpfvldhiptsggkaqslwlyegfly iadfngyltvvdvsdpshmnevfnvltqgsanavsllvq
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0946
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch