The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4492
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32871,AAD36028, 2336 TM0947 Molecular Weight 25490.14 Da.
    Residues 217 Isoelectric Point 6.26
    Sequence mysivegdrvleigfmehfmfldfptlvdipiglpkkgerecdrltrrilskraasvftvpcrvavyres yedalrvnrecqgkgfpvqfwhivekvrevdvflrsypdlsdqireshpelcflrisskmmkskhtreg lnqrieilrehlvfdvenlqricreyrihihdvldslvlalaqqfpleripedppldehglpmqiiapa rtqrspnpe
      BLAST   FFAS

    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch