.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4496

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4496
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26140,AAD36038, 2336 TM0959 Molecular Weight 14973.20 Da.
    Residues 135 Isoelectric Point 7.91
    Sequence mkkvgilnseiskivadmghmdtlavvdlgfpipqgvkkvdlvvdrgkpglmevieillrelkveriila kemdeksiqtkqellkliekmngpvevvtvphkefkemsknvkgiirtgadipysnvilvggvif
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0959

    Name: D-ribose transport via ABC system
    Other genes that carryout this rxn: TM0955 TM0956 TM0958
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + rib-D[e] --> adp[c] + h[c] + pi[c] + rib-D[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0959
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch