.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4501

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Crystallized
    Target Id APC4501
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4609,AAD36047, 2336 TM0968 Molecular Weight 21453.54 Da.
    Residues 182 Isoelectric Point 5.85
    Sequence mfegklvrlrayrkediekalefandpevkkclvpgipfpwrkedeekwyqslnpfstdsysfaieklsd geyiggcsinkidwknsvaevgiflgrpywsqgygtdamrvlvrfifnemnmnkiklhvfsfnerakrv yekigfkvegilrqelfregryhdvivmgllksewedltetdl
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0968
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch