.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4550

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4550
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26112,AAD36118, 2336 TM1041 Molecular Weight 47746.22 Da.
    Residues 428 Isoelectric Point 5.50
    Sequence milmnnpgdkevlrllkqrmesvsqveetvkeiirrvkeegdraleeflkrfekhpvgienlrvtekeis eaqveeefvetikiviedlkefhrrqeersfffttkggsflgemvvplesvgiyvpggkvpyfstllmc avpaivagveriavttppnenggispyilktceilglkeiyrmggahavaaltygtetvkpvdkivgpg gvfvtlakkhvygdvgidsiagpseiaivtdgsadldliaadflsqaehdenamsvvittskevfeklp qvierhlealpeerrktaristenfgtiiltdslkrafeisnliapehlevlvenpfeplghiknagsv flgkytcesvgdygagpnhvlptfrsarfssglrvsdftkkifithlseedfrrkselyskmarwegfe aharaidvrrekl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1041

    Name: histidinol dehydrogenase
    Metabolic Subsystem: Histidine Biosynthesis
    Reaction: : h2o + histd + nad --> h + his-L + nadh
    Classification: EC:1.1.1.23
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1041
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch