.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4566

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4566
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26360,AAD36145, 2336 TM1068 Molecular Weight 54118.17 Da.
    Residues 466 Isoelectric Point 5.43
    Sequence mptivfvgagsvrytiklvgdlaktpdlygsrlvlmdideerlkatyilvtkylrelnaeytveqttsle ealegadfvintalyrapghedgyvhyeimrevgerhgyyrgidsqelnmvsdyytlsnynhlkmsldi akavekiapnawilqtanpvfeitqlvkrltkakivgfchgyahvfhlakvlgvepeeldwqvagvnha iwmnrfrcrgedlypkldewieenasrwepknpwdvdfspaaidmyrfygmypigdtvrsgtwkyhydl etkkrwygkfggidneverpkfyeslreqrkrlmelakevekdptieltkvwpevfttgsesveqhipf inalvndkkarlvlnvenrgvikgipddvmvevpvvvdkegihpekiepdltdrikkfyllprilrmew aleafisgdrrvleeilvrdprtrsyeqavaviddilnlpfneemkkhygs
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1068

    Name: sucrose hydrolyzing enzyme
    Other genes that carryout this rxn:TM0752 TM1414
    Metabolic Subsystem: Sucrose Metabolism
    Reaction: : h2o + sucr --> fru + glc-D
    Classification: EC:3.2.1.26
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1068
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch