.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4570

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4570
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26364,AAD36150, 2336 TM1073 Molecular Weight 54055.57 Da.
    Residues 476 Isoelectric Point 6.20
    Sequence mavkvlsidlgatngkiyevelkdrltvkeikrfrtegtflpgkdrehfvwnlpgfyeeikgvleasdaq svgvdtwgvdfalldengrlvslpyhyrdvrtkgvmkkafevvpkdeifqrtgiqfmeintlyqlysmv lsndpflkttkhllmipdvfnfwlsgemvseytiastsqcysvpdgewaydlleklsipteifpkvvpp gtilgkcrvkkginviatachdtasavvavplegegiyissgtwflvgtelerpllskealernftneg gygkirflknatgmwlleecnriwkkdyseiiesvrnvpgfqafldpdreeflhpgnmperirnylert gqkilerigeisrlifeslafncrwiveqikeltgkrygkihvvggavrndllmsfiasatgktvvagp vdatpignalvqlitlgaianinearkivkesfelktfepknpelwsekyeewrrykgmrv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1073

    Name: rhamnulokinase
    Metabolic Subsystem: Rhamnose Metabolism
    Reaction: : atp + rml --> adp + h + rml1p
    Classification: EC:2.7.1.5
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1073
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch