.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4595

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4595
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26312,AAD36214, 2336 TM1138 Molecular Weight 32264.03 Da.
    Residues 284 Isoelectric Point 7.81
    Sequence mtvtdlskkplllldhvtmqfgglvavddftneiregelvgligpngagkttvfnvitgiytptkgrivf ndiditglrpyqithlgiartfqnirlfsdmtvlenvlvaqhhvlsnpdadrilvkhgkprkghgrfwf wravtkigylkkekemverakdlikrvglekvmyekasslpygeqrkleiaralatepklilldepaag mnpketedlmefikqirkdfnltvlliehdmkvvmgiceriivmdygriiaegtpkeiqndprvieayl grewesv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1138

    Name: L-threonine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1135 TM1137 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + thr-L[e] --> adp[c] + h[c] + pi[c] + thr-L[c]

     
    Name: L-valine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1135 TM1137 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + val-L[e] --> adp[c] + h[c] + pi[c] + val-L[c]

     
    Name: L-alanine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1135 TM1137 TM1136
    Metabolic Subsystem: Transport
    Reaction: ala-L[e] + atp[c] + h2o[c] --> adp[c] + ala-L[c] + h[c] + pi[c]

     
    Name: L-leucine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1135 TM1137 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + leu-L[e] --> adp[c] + h[c] + leu-L[c] + pi[c]

     
    Name: L-isoleucine transport via ABC system
    Other genes that carryout this rxn:TM1139 TM1135 TM1137 TM1136
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + ile-L[e] --> adp[c] + h[c] + ile-L[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1138
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch