.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4605

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4605
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26344,AAD36240, 2336 TM1164 Molecular Weight 61454.81 Da.
    Residues 558 Isoelectric Point 5.36
    Sequence mkdvsivlsgeagqgiqtvenvltrvlkdsgfhvfatkeymsrvrggnntteirvssrrvrsfvdridvl iplgkgaterlknritektlvigeeefikespgekivipflniakqigksiyansvaigflsgllgade salkdqitrqfsskgedivndniraalegykkgqelsqkiefdvekdpsiknevllngaeavglgaiag gcnfvssypmspstsvlvflaqhkndfgivveqaedeiaamnmiigawyagarglvttsgggfalmeea lslagmiespavihlaqrpgpatglptrteqgdlnlalyaghgdfprviyapgnveeafyltqkafnva dkyqvpvfvltdqylvdsyynlpgfdlnelkvekhfikttrdyiryaitedgisprgipgygeglvrvd sdehdefghitedfntrvrmvnkrlrkgetlkkeivkpkligdenyrvllvawgstlepikeaiegldg vallhfsqvwpidesvatyfekaekvvavegnatgqfanlirqvtgfhikdrilkynglqfsveelkekiaevl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1164

    Name: ferredoxin oxidoreductase
    Other genes that carryout this rxn:TM0405 TM0406 TM1165
    Metabolic Subsystem: Citric Acid Cycle
    Reaction: : akg + coa + fdxo-4:2 --> co2 + fdxr-4:2 + h + succoa

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1164
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch