.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4608

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4608
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32780,AAD36243, 2336 TM1167 Molecular Weight 22436.98 Da.
    Residues 190 Isoelectric Point 6.39
    Sequence mthivhkgldffvkpqkvslnlnmkigslkvhpedlkllmkkvpvfmmsyydnkafmereleissadfpn gvvffsyyepvpaelnwdvdkklisqltkyfhlydlvhsinslidetegsslhigvyeewldrimvkvp senteelrnmlsrfsllyttkilwkifrgnfeelkkrtheiayklyevagf
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch