.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4620

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4620
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26326,AAD36265, 2336 TM1190 Molecular Weight 39587.09 Da.
    Residues 350 Isoelectric Point 5.52
    Sequence mkvkapgriniigehtdyndgyvlpfavnryvflsiegserfifhsenvnetvemekieklnkwtdyisg viasfekrgyrvspvkisvssnlpigaglsssaalevatayaiseyfgfnvpklelvkiareaevefvg vrcgimdqftavfgkkdhaifldtmtleyeyvplklegyeinlvdsnvkhelssseynrrrqeceevlk tlekksfrevtkedlerlsgtlrkraqhvleenervlksvqalkegdfetlgkllfssheslrdlyevs ceetdfivdylrgkegilgarmvgggfgggvivlskkgafgkikeelvesyrkrfgidlifheiessdg vqki
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1190

    Name: galactokinase
    Metabolic Subsystem: Galactose metabolism
    Reaction: : atp + gal --> adp + gal1p + h
    Classification: EC:2.7.1.6
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1190
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch