The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4622
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26284,AAD36270, 2336 TM1195 Molecular Weight 75473.22 Da.
    Residues 649 Isoelectric Point 5.52
    Sequence mlgvcyypehwgtekveedfrrmkelgieyvrigefawsriesergkfnwdwldktlelaekmglkivlg tptatppkwlidehpeilpvdkdgrvknfgsrrhycfsspvyreevkrivtiivkrygkhpavagwqtd neygchdtvrcycprckkafqkwlerkyegdikklneawgtvfwsqeyrsfdeielpnltpadpnpshl ldyyrlasdqvvefnklqveiireyspgrfithnfmsgftdfdhyklskdldfatwdnyplghtlvflr mkgetknpfdrvghpdiisfshdlyrgvgrgrfwvmeqqagpvnwapynlwpakgavrlwtwqafahga evvsyfrwrqapfaqeqmhsgllapdsapypgyhevkqvfeelknidinepvesevalvfdyetawvfs iqphgegvnyidlvfrfysalrrlglnvdivppgssldgykmivvpslaivkeevldtfkkydgllvlg prsgsktetfqippemppgllkeiipvevrqveslgdnvetlvwngkeypvsiwredvdptiteviarf kdgfgaifrkenvfylafwpngdflvdffealskesgietkrmpegvriqrrgeyvfsfnftseevdle iptkvqivlgdqkippyglliwkener
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1195

    Name: b-galactosidase
    Other genes that carryout this rxn:TM1193
    Metabolic Subsystem: Alternate Carbon Metabolism
    Reaction: : h2o + lcts --> gal + glc-D
    Classification: EC:

    Ligand Information
    Model TM1195
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch