The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC4635.3
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32419,NP_229042.1,, 243274 TM1237 Molecular Weight 27512.78 Da.
    Residues 244 Isoelectric Point 7.17
    Sequence ncvalpicperehrgfynfavffagcnldclfcqnidhkymvkdgrisegkivdidelveiamkprvscv cffggdptpwtvfalefavklgnrrricwetnglahprimermarvslesggivkidwkafspevyeal tgvdgksavrrimenvqlvssmgkgreipllvisvlviphyidekeiegiagfissvdpeiplvllafa pqhlmsdlpttrkhhmervkqkalekglkrvfvenv
      BLAST   FFAS

    Ligand Information
    Model TM1237
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch