.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4653

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4653
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26258,AAD36348, 2336 TM1273 Molecular Weight 55432.71 Da.
    Residues 482 Isoelectric Point 5.42
    Sequence mryrpvigleihvqlstktkafcscpadvfelppntaicpvctgqpgalpvpneemirfavktalalnck ihkysrfdrknyfypdlpkgyqisqyfypiategfleidgdegrkkvrirrlhleedagklvhegdsit rasyslvdmnrcgvplieivtepdissprearvfmeklrsivrylgvstgdmekgalrcdanisvvdte tgrqsnrvevknmnsfrfveraleyeferivkamergedveretrgwdmatkitvsmrgkeeesdyryf pepdippvvlsdeyleevkkelpelpdekaerfmreyglpeydakvltsskelaeffeecvkvvnrpkd lsnwimtevlrelnernieiteskltpqhfadlfklmdegkisikiakeifpevfetgkmpsqiveekg ltqindeklieelvkkameqnpkavqdyksgkkkaagffvgyvmretkgkanpeltnriiqkllege
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1273

    Name: aspartyl-tRNA(Asn) amidotransferase
    Other genes that carryout this rxn: TM0252 TM1272
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : asptrna(asn) + atp + gln-L + h2o --> adp + asntrna + glu-L + h + pi
    Classification:
     
    Name: glutamyl-tRNA(Gln) amidotransferase
    Other genes that carryout this rxn: TM0252 TM1272
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : atp + gln-L + glutrna(gln) + h2o --> adp + glntrna + glu-L + h + pi
    Classification:
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1273
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch