.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4655

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4655
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32205,AAD36352, 2336 TM1277 Molecular Weight 73606.41 Da.
    Residues 664 Isoelectric Point 5.21
    Sequence mifaldvgtrkiagliaveekgtirivdseliehktrtmfdgqvhdvlgvaetvkevkerlesrneielk evavalagrflktqvgeaeldfskvghitredvmkleieavtkaqesveedffcvgysvveyrldgmwm kkleghrggkayvkvvsaflpvhvvdslmrvletvgltpvhvtlepiaamdltvpedlrylnislvdvg agtsdiaiskegtvvaygmipmagdeiteaigkkflldfqtaehvkrtvfseervkvknildreielnv revseaikpvvdqitteistvvtelnggapsvvmvvgggakvpgfveslarkldlpldrvslksvestg lvedltgkvkgseyitpvgiaysamrnrgsvfsqvfvngvpvklmggvgrysvmqvliqagyrfsslvg gemisfelngktllrpkrrtsvkifvngeeanlssrvkhgdridiqteeeetplrikdlvkpvkvklpd ggveevfpeivkngtpvppdadveegdvvsfpekikiseikskisygktrivvngeekwislvnfdllk gevplkddeevplgeeidlvekgrktleealevphitvsfngelkkiplkilhrideervelkdfkpmv idllkdlkldglkdyellkngrramftelledgdviefrikk
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1277
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch