.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4656

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4656
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32807,AAD36354, 2336 TM1279 Molecular Weight 14126.71 Da.
    Residues 125 Isoelectric Point 5.28
    Sequence mkkiilallvivsvqmmgdvfvsfsydfsegetvssvgmdtgeftagvelwdfssicffvgavrnldlgd fmftletrvgfsskpylavvnffwkkhegvkwgfgysitlkdssirfplfvrlgw
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch