.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4724

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4724
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26236,AAD36469, 2336 TM1398 Molecular Weight 27858.01 Da.
    Residues 233 Isoelectric Point 9.62
    Sequence mripqhvaiimdgngrwakkrglprikghqrgaevlhntvkwslelgikyltafsfstenwkrpkeevef lmdlfvqmidremellrrervrvrilgrkeglpekvlkkwqeveektkefdrmtliiafnyggrreild avefilkdvshgkkielteetfrqylylpdvpdpdliirtsgemrlsnfllwqsayselyffkklwpdf tkrdflraiesyskrerrfggling
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1398

    Name: Undecaprenyl diphosphate synthase
    Metabolic Subsystem: Lipid Biosynthesis
    Reaction: : frdp + ipdp --> ppi + udcpdp

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1398
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch