The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4725
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26308,AAD36471, 2336 TM1400 Molecular Weight 42103.48 Da.
    Residues 384 Isoelectric Point 6.17
    Sequence mgkflkkhyimapgptpvpndiltegaketihhrtpqfvsimeetlesakyifqtkhnvyafastgtgam eaavanlvspgdkvivvvagkfgerwrelcqaygadiveialewgdavtpeqieealnknpdakvvftt ysetstgtvidlegiarvtkekdvvlvtdavsalgaeplkmdewgvdlvvtgsqkglmlppglalisln dkawglveksrspryyfdlrayrksypdnpytpavnmiymlrkalqmikeegienvwerhrilgdatra avkalglellskrpgnvvtavkvpegidgkqipkimrdkygvtiaggqaklkgkifriahlgymspfdt itaisaleltlkelgyefelgvgvkaaeavfakefige
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1400

    Name: e L-alanine-alpha-keto acid aminotransferase
    Metabolic Subsystem: Alanine and Aspartate Metabolism
    Reaction: : ala-L + oaa <==> asp-L + pyr
    Classification: EC:
    Name: serine-pyruvate aminotransferase
    Metabolic Subsystem: Glycine and Serine Metabolism
    Reaction: : pyr + ser-L <==> ala-L + hpyr


    Ligand Information
    Model TM1400
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch