.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4738

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Purified
    Target Id APC4738
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26184,AAD36494, 2336 TM1424 Molecular Weight 18323.46 Da.
    Residues 164 Isoelectric Point 5.53
    Sequence mlalerhfekveeilkkygykrenlikilleiqeiyrylpedvinyvstamgippakiygvatfyaqfsl kpkgkytimvcdgtachmagspevlkaieeetgltpgnvtedlmfsldqvgclgacalapvmvingevy gnltadkvkeilrkikekeresanv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1424

    Name: NAD-linked hydrogenase
    Other genes that carryout this rxn:TM1426 TM1425
    Metabolic Subsystem: Energy Metabolism
    Reaction: : h + nadh <==> h2 + nad
    Classification: EC:1.12.1.2
     
    Name: Official Name Ferredoxin hydrogenase
    Other genes that carryout this rxn:TM1426 TM1425
    Metabolic Subsystem: Energy Metabolism
    Reaction: : fdxr-4:2 + h --> fdxo-4:2 + h2

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1424
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch