.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4739

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4739
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26384,AAD36495, 2336 TM1425 Molecular Weight 68677.75 Da.
    Residues 626 Isoelectric Point 7.85
    Sequence mfknakefvqyanklktlrekklngvsiyvcvgtgctakgalkvysafeeelkkrnllgqvtlekidddk vtlnrtgccgrcssgplvkimpyrffysnvapedvpeivdrtvlkgepierlfltdpltgekvpriedt tlfknqdfyimeaigesecdsiedyiarsgyeslvkaltsmtpeeiietvkasglrgrggggfptglkw eftrkaqgdikfvvcngdegdpgafmnrtllerdphlvlegmiiagyavgaqkgyayiraeypfavkmf kkaiedarklgllgenilgtgfsfdlevkegagafvcgeetallasiegkrgmprpkppfpaqsglwgk ptlinnvetyaniprilrdgvenyrkrgtenspgtkmfsvagplkatgiievefgttlrdiiynicggf vegeefkavqiggpsgaclsedfidmpldydtlkkadamvgsggivvitkktcmvevarffldftkres cgkcvpcregtmqaynilekfthgkatyedlktlehlsktiktaslcglgktapnpilstlklfreeyi ahiegecpsgmctafkkyvinpdickgcglcarscpqnaitgergkpytidqekcvkcglcaskcpfkaielv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1425

    Name: NAD-linked hydrogenase
    Other genes that carryout this rxn:TM1426 TM1424
    Metabolic Subsystem: Energy Metabolism
    Reaction: : h + nadh <==> h2 + nad
    Classification: EC:1.12.1.2
     
    Name: Official Name Ferredoxin hydrogenase
    Other genes that carryout this rxn:TM1426 TM1424
    Metabolic Subsystem: Energy Metabolism
    Reaction: : fdxr-4:2 + h --> fdxo-4:2 + h2

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1425
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch