.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4742.1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Selected
    Target Id APC4742.1
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26294,NP_229232.1, 3.40.50.720, 243274 TM1432 Molecular Weight 40145.27 Da.
    Residues 365 Isoelectric Point 5.36
    Sequence mkavvigggvfgsliareltkydlevtlieknldvgwgvtkansavvhagyddppesvraqfcasgnamy edlskeldfdfkrigsfvvafndeelkelerllkqgeengvpgltilerdevlsmepnlnpevkyalya ptagitepwmvaiaavenavqnglklvlgesvvgfekvngrvrkvhtsrgeyeadivincaglhadeia klagaeyvplhprkgeyilldkklqglvkrvifptptkiskgilvlptvdggillgptaedlpeemkdr pittreglekvreftrrlvpsldfslvvktfsglrpespqkdffikvsetvknfvnvmatrspgltaap avakyvveeliqekmripl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1432

    Name: glycerol-3-phosphate dehydrogenase (NAD)
    Other genes that carryout this rxn:TM0378
    Metabolic Subsystem: Alternate Carbon Metabolism
    Reaction: : glyc3p + nad <==> dhap + h + nadh
    Classification: EC:1.1.1.94
     
    Name: NADH oxidase
    Other genes that carryout this rxn: TM1433
    Metabolic Subsystem: Others
    Reaction: : h + nadh + o2 --> h2o2 + nad

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1432
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch