The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4743
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26436,AAD36503, 2336 TM1433 Molecular Weight 44859.70 Da.
    Residues 403 Isoelectric Point 5.77
    Sequence mrvdvmvigagaagmaaalkakeegaevllverdertggilnqcihngfglhyfrqeltgpeyaerfqek mekmgiraltnayvkrvedrrvilvteqgieevevgalvyatgarerpfgslmipgdrpsgiftagvaq rlinienrlpgkralilgsgdiglimarrltlegmevvgvverlpyaggllrnviqcledyniplylss tvvevrgrerleevvvakvdeqfrpiprtervfkvdtlvlsvglipqvelienlvvknptsrgvgvsni gqtsrdwifsagnctvifdlvdyvsyegetagryaakfvkgeiprekipvrpgknvmvvhpiwytpaep ltlylrvkkpmekgrlvvgrfarefedlvpsemlrvkisdrdlegldeivvsveevn
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1433

    Name: NADH oxidase
    Other genes that carryout this rxn:TM1432
    Metabolic Subsystem: Others
    Reaction: : h + nadh + o2 --> h2o2 + nad


    Ligand Information
    Model TM1433
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch