The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4744
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32630,AAD36504, 2336 TM1434 Molecular Weight 15280.12 Da.
    Residues 138 Isoelectric Point 9.39
    Sequence mfknvvcvqcpigckikveltedghiksitgnrcprgveyakdeikdpkrvvptsirvlngelplasvkt dkpipkrfipelmkivreikveapvkagdvvlrdlfgtganlvvtrtvrrlengskeiqkdstgwsdg
      BLAST   FFAS

    Ligand Information
    Model TM1434
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch