The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4756
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32264,AAD36524, 2336 TM1456 Molecular Weight 9220.26 Da.
    Residues 83 Isoelectric Point 10.21
    Sequence mahkksggvakngrdslpkylgvkvgdgqivkagnilvrqrgtrfypgknvgmgrdftlfalkdgrvkfe tknnkkyvsvyee
      BLAST   FFAS

    Ligand Information
    Model TM1456
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch