The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4782
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26134,AAD36585, 2336 TM1518 Molecular Weight 43813.02 Da.
    Residues 401 Isoelectric Point 5.50
    Sequence mnvvvqkyggssvatperiknvaqrikkkvdegykvvvvvsamgkttdnliklakeisprpdsreldmll atgeqvsaallsmalkdlgvkakslnafqvkikttphhtsarivdiddsvirenlkdydvlvvtgfqgv nehgdlttlgrggsdtsavalaaklrvpceiysdvdgiytcdprvhprakklayitydealeltalgak vlhsrsveiakkygipiycassfteeegtmvverlpewleepvvtgatishgqikvsisflpkdvkyit aifeevgkralnvdmislvpsngkvflsftiledhkedldealkealrdvegwkstyeggfaklsivgv gmrtspgvaarffealeragvtpelvttseikisclvpeekaeealksvieefel
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM1518

    Name: aspartate kinase
    Other genes that carryout this rxn:TM0547
    Metabolic Subsystem: Threonine Metabolism
    Reaction: : asp-L + atp <==> 4pasp + adp
    Classification: EC:

    Ligand Information
    Model TM1518
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch