.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4783

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4783
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26254,AAD36590, 2336 TM1523 Molecular Weight 36619.57 Da.
    Residues 327 Isoelectric Point 6.07
    Sequence mkvkvgvvgatgevgrtmvkvleefnvpvtelrlfasersvgkeiefkgekfkvellteesmkwkcdyfl fsagasvsrkfapiaaengvtvidnssafrmekeiplvvpevnayllkgytgiianpncstiqmilsiy klhevygieeifvstyqsvsgaghkgieellaqergenvmkvfpkpihrnvipligdiqenlfsqeemk mvnetrkilndysirvypttvrvpvlyghseaimvrlkkpyeslekvreviasgedvvvtddlitpvdv agknetyvcrlratdersilfwnvadnirvgaatnavrillkhaemngkv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1523

    Name: aspartate-semialdehyde dehydrogenase
    Metabolic Subsystem: Threonine Metabolism
    Reaction: : aspsa + nadp + pi <==> 4pasp + h + nadph
    Classification: EC:1.2.1.11
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1523
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch