.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4840

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4840
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26222,AAD36676, 2336 TM1609 Molecular Weight 12328.51 Da.
    Residues 108 Isoelectric Point 5.45
    Sequence mkvkivtpygivydresdfisfrtvegsmgilprrapivtqlsvcdvkiksgddeyhlkvaggfllcdgk dviiiteeagreedispdrfmearervervrrffqssl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1609

    Name: H+-exporting ATPase
    Other genes that carryout this rxn:TM1616 TM1611 TM1614 TM1612 TM1615 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: atp[c] + h[c] + h2o[c] --> adp[c] + h[e] + pi[c]
    Classification: EC:3.6.3.6
     
    Name: ATP synthase (10 protons for three ATP)
    Other genes that carryout this rxn:TM1616 TM1611 TM1614 TM1612 TM1615 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: adp[c] + h[e] + pi[c] --> atp[c] + h[c] + h2o[c]
    Classification: EC:3.6.3.14
     
    Name: ATP synthase (four protons for one ATP)
    Other genes that carryout this rxn:TM1616 TM1611 TM1614 TM1612 TM1615 T
    Metabolic Subsystem: Energy Metabolism
    Reaction: adp[c] + h[e] + pi[c] --> atp[c] + h[c] + h2o[c]
    Classification: EC:3.6.3.14
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1609
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch