The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Work Stopped
    Target Id APC4862
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS32367,AAD36731, 2336 TM1664 Molecular Weight 24066.62 Da.
    Residues 210 Isoelectric Point 6.97
    Sequence msekfehyytveptsklkvrearlvlkngheyifktpsgvysygkidkatqvllenlkvhgkkvldlgcg ygvigivlkkeypdlevymsdinkravefakinakdhnvevdirwgnlyepwedmkfdmivcnppivag kkvwmeivksapefleeggslqivayhnkggrrirdfmkevfgnveelcktggirvyrsvkglkededn ae
      BLAST   FFAS

    Ligand Information
    Model TM1664
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch