.
The Open Protein Structure Annotation Network
PDB Keyword
.

APC4918

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site MCSG
    Status Cloned
    Target Id APC4918
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS26138,AAD36837, 2336 TM1774 Molecular Weight 44272.75 Da.
    Residues 401 Isoelectric Point 6.00
    Sequence mfdkqefvsklvteekakivllvmdglgdipvngktplqaantpnldnlakesdlgqtipvlpgitpgsg pghlslfgydpikyqigrgilealgigvevgekdvvaranfatwdgkvvldrragrpateesakvvqll sekikkiedveitfypgkehrfvvkftgeglgdkvtdadpqkeghpmvwaegldepskktarivnelik kiaevlkdnpkinfalirgfskypdlpkfpqvykmkagaiatypmyrglaklvgmeiietgqtvadeik tlkekwndydffyvhvkktdsygedgkfeekvkvieevdaiipeivslnpdvlvitgdhstpvplkahs whpvplliwskytrrglsqafnefecargtlgtihasdvmtlalayagklekfga
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM1774

    Name: phosphoglycerate mutase
    Other genes that carryout this rxn: TM1374
    Metabolic Subsystem: Glycolysis/Gluconeogenesis
    Reaction: : 2pg <==> 3pg
    Classification: EC:5.4.2.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM1774
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch